Josephin 2 (JOSD2) (NM_138334) Human Recombinant Protein

CAT#: TP309025M

Recombinant protein of human Josephin domain containing 2 (JOSD2), 100 µg

Product Images

Coomassie blue staining of purified JOSD2 protein (Cat# TP309025). The protein was produced from HEK293T cells transfected with JOSD2 cDNA clone (Cat# RC209025) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209025 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDV
  NVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLD
  SKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_612207
• Locus ID: 126119
• UniProt ID: Q8TAC2, A0A024R4G2
• Cytogenetics: 19q13.33
• Refseq Size: 863
• Refseq ORF: 564
• Synonyms: SBBI54
• Summary: This gene encodes a protein containing a Josephin domain. Josephin domain-containing proteins are deubiquitinating enzymes which catalyze the hydrolysis of the bond between the C-terminal glycine of the ubiquitin peptide and protein substrates. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
• Protein Families: Druggable Genome