MMP14 (NM_004995) Human Recombinant Protein
CAT#: TP308917
Recombinant protein of human matrix metallopeptidase 14 (membrane-inserted) (MMP14), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208917 representing NM_004995
Red=Cloning site Green=Tags(s) MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQK FYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYAT YEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIG GDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQ QLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVM DGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQK LKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVF FFRRHGTPRRLLYCQRSLLDKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004986 |
Locus ID | 4323 |
UniProt ID | P50281 |
Cytogenetics | 14q11.2 |
Refseq Size | 3558 |
Refseq ORF | 1746 |
Synonyms | MMP-14; MMP-X1; MT-MMP; MT-MMP 1; MT1-MMP; MT1MMP; MTMMP1; WNCHRS |
Summary | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease, Transmembrane |
Protein Pathways | GnRH signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401554 | MMP14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401554 | Transient overexpression lysate of matrix metallopeptidase 14 (membrane-inserted) (MMP14) |
USD 436.00 |
|
PH308917 | MMP14 MS Standard C13 and N15-labeled recombinant protein (NP_004986) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review