FXYD4 (NM_173160) Human Recombinant Protein

CAT#: TP308892

Recombinant protein of human FXYD domain containing ion transport regulator 4 (FXYD4), 20 µg

Product Images

Coomassie blue staining of purified FXYD4 protein (Cat# TP308892). The protein was produced from HEK293T cells transfected with FXYD4 cDNA clone (Cat# RC208892) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208892 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQH
  SPVPEKAIPLITPGSATTC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_775183
• Locus ID: 53828
• UniProt ID: P59646
• Cytogenetics: 10q11.21
• Refseq Size: 787
• Refseq ORF: 267
• Synonyms: CHIF
• Summary: This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found.[provided by RefSeq, May 2010]
• Protein Families: Ion Channels: Other, Transmembrane