FXYD4 (NM_173160) Human Mass Spec Standard
CAT#: PH308892
FXYD4 MS Standard C13 and N15-labeled recombinant protein (NP_775183)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208892 |
Predicted MW | 9.4 kDa |
Protein Sequence |
>RC208892 protein sequence
Red=Cloning site Green=Tags(s) MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQH SPVPEKAIPLITPGSATTC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_775183 |
RefSeq Size | 787 |
RefSeq ORF | 267 |
Synonyms | CHIF |
Locus ID | 53828 |
UniProt ID | P59646 |
Cytogenetics | 10q11.21 |
Summary | This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found.[provided by RefSeq, May 2010] |
Protein Families | Ion Channels: Other, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406692 | FXYD4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406692 | Transient overexpression lysate of FXYD domain containing ion transport regulator 4 (FXYD4) |
USD 436.00 |
|
TP308892 | Recombinant protein of human FXYD domain containing ion transport regulator 4 (FXYD4), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review