DCUN1D2 (NM_001014283) Human Recombinant Protein

CAT#: TP308865L

Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) (DCUN1D2), 1 mg

Product Images

Coomassie blue staining of purified DCUN1D2 protein (Cat# TP308865). The protein was produced from HEK293T cells transfected with DCUN1D2 cDNA clone (Cat# RC208865) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208865 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYG
  RYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKAL
  LPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPR
  DTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001014305
• Locus ID: 55208
• UniProt ID: Q6PH85
• Cytogenetics: 13q34
• Refseq Size: 3046
• Refseq ORF: 777
• Synonyms: C13orf17
• Summary: Potently stimulates the neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes from the NEDD8-conjugating E2 enzyme UBC12. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.[UniProtKB/Swiss-Prot Function]