N4BP3 (NM_015111) Human Recombinant Protein

CAT#: TP308635L

Recombinant protein of human Nedd4 binding protein 3 (N4BP3), 1 mg

Product Images

Coomassie blue staining of purified N4BP3 protein (Cat# TP308635). The protein was produced from HEK293T cells transfected with N4BP3 cDNA clone (Cat# RC208635) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208635 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATAPGPAGIAMGSVGSLLERQDFSPEELRAALAGSRGSRQPDGLLRKGLGQREFLSYLHLPKKDSKSTK
  NTKRAPRNEPADYATLYYREHSRAGDFSKTSLPERGRFDKCRIRPSVFKPTAGNGKGFLSMQSLASHKGQ
  KLWRSNGSLHTLACHPPLSPGPQASQARAQLLHALSLDEGGPEPEPSLSDSSSGGSFGRSPGTGPSPFSS
  SLGHLNHLGGSLDRASQGPKEAGPPAVLSCLPEPPPPYEFSCSSAEEMGAVLPETCEELKRGLGDEDGSN
  PFTQVLEERQRLWLAELKRLYVERLHEVTQKAERSERNLQLQLFMAQQEQRRLRKELRAQQGLAPEPRAP
  GTLPEADPSARPEEEARWEVCQKTAEISLLKQQLREAQAELAQKLAEIFSLKTQLRGSRAQAQAQDAELV
  RLREAVRSLQEQAPREEAPGSCETDDCKSRGLLGEAGGSEARDSAEQLRAELLQERLRGQEQALRFEQER
  RTWQEEKERVLRYQREIQGGYMDMYRRNQALEQELRALREPPTPWSPRLESSKI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 60.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055926
• Locus ID: 23138
• UniProt ID: O15049
• Cytogenetics: 5q35.3
• Refseq Size: 5987
• Refseq ORF: 1632
• Synonyms: LZTS4
• Summary: Plays a role in axon and dendrite arborization during cranial nerve development. May also be important for neural crest migration and early development of other anterior structures including eye, brain and cranial cartilage.[UniProtKB/Swiss-Prot Function]