RAP2A (NM_021033) Human Recombinant Protein

CAT#: TP307180M

Recombinant protein of human RAP2A, member of RAS oncogene family (RAP2A), 100 µg

Product Images

Coomassie blue staining of purified RAP2A protein (Cat# TP307180). The protein was produced from HEK293T cells transfected with RAP2A cDNA clone (Cat# RC207180) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207180 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL
  YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGC
  PFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_066361
• Locus ID: 5911
• UniProt ID: P10114
• Cytogenetics: 13q32.1
• Refseq Size: 4358
• Refseq ORF: 549
• Synonyms: K-REV; KREV; RAP2; RbBP-30
• Summary: Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form interacts with and regulates several effectors including MAP4K4, MINK1 and TNIK. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it is part of several signaling cascades and may regulate cytoskeletal rearrangements, cell migration, cell adhesion and cell spreading.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome