ACYP1 (NM_001107) Human Recombinant Protein

CAT#: TP307110M

Recombinant protein of human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1, 100 µg

Product Images

Coomassie blue staining of purified ACYP1 protein (Cat# TP307110). The protein was produced from HEK293T cells transfected with ACYP1 cDNA clone (Cat# RC207110) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207110 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRG
  SPKSHIDKANFNNEKVILKLDYSDFQIVK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001098
• Locus ID: 97
• UniProt ID: P07311
• Cytogenetics: 14q24.3
• Refseq Size: 621
• Refseq ORF: 297
• Synonyms: ACYPE
• Summary: This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
• Protein Pathways: Pyruvate metabolism