BATF (NM_006399) Human Recombinant Protein

CAT#: TP307104M

Recombinant protein of human basic leucine zipper transcription factor, ATF-like (BATF), 100 µg

Product Images

Coomassie blue staining of purified BATF protein (Cat# TP307104). The protein was produced from HEK293T cells transfected with BATF cDNA clone (Cat# RC207104) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207104 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRK
  EIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006390
• Locus ID: 10538
• UniProt ID: Q16520
• Cytogenetics: 14q24.3
• Refseq Size: 953
• Refseq ORF: 375
• Synonyms: B-ATF; BATF1; SFA-2; SFA2
• Summary: The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors