PDP2 (NM_020786) Human Recombinant Protein

CAT#: TP307071M

Recombinant protein of human pyruvate dehydrogenase phosphatase isoenzyme 2 (PDP2), 100 µg

Product Images

Coomassie blue staining of purified PDP2 protein (Cat# TP307071). The protein was produced from HEK293T cells transfected with PDP2 cDNA clone (Cat# RC207071) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207071 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEE
  DDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIF
  DGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLR
  VYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLH
  VANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGD
  VQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSN
  EDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAE
  RLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 59.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065837
• Locus ID: 57546
• UniProt ID: Q9P2J9
• Cytogenetics: 16q22.1
• Refseq Size: 7042
• Refseq ORF: 1587
• Synonyms: PDPC 2; PPM2B; PPM2C2
• Summary: This gene is a mitochondrial protein that functions as a phosphatase and is involved in the enzymatic resetting of the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2016]
• Protein Families: Druggable Genome, Phosphatase