DNAJB2 (NM_001039550) Human Recombinant Protein

CAT#: TP306769L

Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 1, 1 mg

Size: 20 ug 100 ug 1 mg


USD 9,200.00

6 Weeks*

Size
    • 1 mg

Product Images

Frequently bought together (2)
DNAJB2 mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
    • 100 ul

USD 447.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "DNAJB2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC206769 protein sequence
Red=Cloning site Green=Tags(s)

MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGR
EGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDLGPFSELQNRGSRHSGPFFTF
SSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENGQERVEVEEDGQLKSVTINGVPD
DLALGLELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPADVF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001034639
Locus ID 3300
UniProt ID P25686
Cytogenetics 2q35
Refseq Size 1978
Refseq ORF 831
Synonyms CMT2T; DSMA5; HSJ-1; HSJ1; HSPF3
Summary This gene is almost exclusively expressed in the brain, mainly in the neuronal layers. It encodes a protein that shows sequence similarity to bacterial DnaJ protein and the yeast homologs. In bacteria, this protein is implicated in protein folding and protein complex dissociation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2011]

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.