C10orf68 (CCDC7) (NM_001026383) Human Recombinant Protein

CAT#: TP306704M

Recombinant protein of human coiled-coil domain containing 7 (CCDC7), transcript variant 2, 100 µg

Product Images

Coomassie blue staining of purified CCDC7 protein (Cat# TP306704). The protein was produced from HEK293T cells transfected with CCDC7 cDNA clone (Cat# RC206704) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206704 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKPVKHLLTTSNKSANVPALTTKKGLHNLPLSPELKEKHNAKLIHDKIEPMVLRSPPTGESILRYALPIP
  SSKTKNLLPEDEMIGKIIKHLKMVVSTLEETYGHCDQNGEEPFVKHEHEELSLSVGDDMNSFLTYCSQFA
  AQLEEALKEEQNILESLFKWFQWQVNQMEEISKDQTLLQAEPPKPDKTVILNIAEIVRLVQRFEELKNRL
  KQRSKSSVKVMLSKTMDKENRPEAVKSCEALAQKIEEFLEAHSTDEFKDVSATEPQTAHSMTNRFNAMLK
  VFENQANMLERAVNDQVLLDAEYKQMQCDFQLLSEEKLVLENELQKLKDKEKTKPTNNRTKKAVKTVKKK
  DKGKSEDSEKKMSPEKEFKIKEDLDQVQKVARLEIENKVLQEQLKQALQEAEKAKHQLNYFLNQEKLLKS
  EGKTETTMQVGNSQTKVKGEDSKNIPLEKETRKSLVSDSGGQRTSDKIQEYPQITAQSGRLIEKRC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 55.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001021554
• Locus ID: 79741
• UniProt ID: Q96M83, A0A384NKY2, Q9H943
• Cytogenetics: 10p11.22
• Refseq Size: 1970
• Refseq ORF: 1458
• Synonyms: BIOT2; BioT2-A; BioT2-B; BioT2-C; C10orf68
• Summary: May play a role in tumorigenesis.[UniProtKB/Swiss-Prot Function]