Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein

CAT#: TP306285M

Recombinant protein of human centrin, EF-hand protein, 1 (CETN1), 100 µg

Product Images

Coomassie blue staining of purified CETN1 protein (Cat# TP306285). The protein was produced from HEK293T cells transfected with CETN1 cDNA clone (Cat# RC206285) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206285 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMK
  KMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDE
  ELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004057
• Locus ID: 1068
• UniProt ID: Q12798, A0A140VJG3
• Cytogenetics: 18p11.32
• Refseq Size: 1161
• Refseq ORF: 516
• Synonyms: CEN1; CETN
• Summary: The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq, Jan 2015]
• Protein Families: Druggable Genome