C14orf142 (GON7) (NM_032490) Human Recombinant Protein

CAT#: TP306178

Recombinant protein of human chromosome 14 open reading frame 142 (C14orf142), 20 µg

Product Images

Coomassie blue staining of purified GON7 protein (Cat# TP306178). The protein was produced from HEK293T cells transfected with GON7 cDNA clone (Cat# RC206178) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206178 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDG
  DDEDDAEDENNIDNRTNFDGPSAKRPKTPS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115879
• Locus ID: 84520
• UniProt ID: Q9BXV9
• Cytogenetics: 14q32.12
• Refseq Size: 1191
• Refseq ORF: 300
• Synonyms: C14orf142; PNAS-127
• Summary: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. GON7 likely plays a supporting role to the catalytic subunit OSGEP in the complex.[UniProtKB/Swiss-Prot Function]