NME5 (NM_003551) Human Recombinant Protein

CAT#: TP306058

Recombinant protein of human non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) (NME5), 20 µg

Product Images

Coomassie blue staining of purified NME5 protein (Cat# TP306058). The protein was produced from HEK293T cells transfected with NME5 cDNA clone (Cat# RC206058) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206058 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNL
  TAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIR
  FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPIVEE
  PY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003542
• Locus ID: 8382
• UniProt ID: P56597, A0A0S2Z4L9
• Cytogenetics: 5q31.2
• Refseq Size: 1243
• Refseq ORF: 636
• Synonyms: NM23-H5; NM23H5; RSPH23
• Summary: Does not seem to have NDK kinase activity. Confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes including Gpx5. May play a role in spermiogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Purine metabolism, Pyrimidine metabolism