GPSM3 (NM_022107) Human Recombinant Protein

CAT#: TP305820M

Recombinant protein of human G-protein signaling modulator 3 (AGS3-like, C. elegans) (GPSM3), 100 µg

Product Images

Coomassie blue staining of purified GPSM3 protein (Cat# TP305820). The protein was produced from HEK293T cells transfected with GPSM3 cDNA clone (Cat# RC205820) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205820 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVA
  EAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLL
  RVQGGGRMEEQRSRPPTHTC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071390
• Locus ID: 63940
• UniProt ID: Q9Y4H4, A0A024RCP6
• Cytogenetics: 6p21.32
• Refseq Size: 1472
• Refseq ORF: 480
• Synonyms: AGS4; C6orf9; G18; G18.1a; G18.1b; G18.2; NG1
• Summary: Interacts with subunit of G(i) alpha proteins and regulates the activation of G(i) alpha proteins.[UniProtKB/Swiss-Prot Function]