TLX3 (NM_021025) Human Recombinant Protein

CAT#: TP305739

Recombinant protein of human T-cell leukemia homeobox 3 (TLX3), 20 µg

Product Images

Coomassie blue staining of purified TLX3 protein (Cat# TP305739). The protein was produced from HEK293T cells transfected with TLX3 cDNA clone (Cat# RC205739) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205739 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLPASFAGLGAPF
  EDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFT
  AAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQV
  KTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEED
  SSKVPAVTSLV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_066305
• Locus ID: 30012
• UniProt ID: O43711
• Cytogenetics: 5q35.1
• Refseq Size: 1513
• Refseq ORF: 873
• Synonyms: HOX11L2; RNX
• Summary: The protein encoded by this gene is an orphan homeobox protein that encodes a DNA-binding nuclear transcription factor. A translocation [t(5;14)(q35;q32)] involving this gene is associated with T-cell acute lymphoblastic leukemia (T-ALL) in children and young adults. [provided by RefSeq, Nov 2015]
• Protein Families: Transcription Factors