NANP (NM_152667) Human Recombinant Protein

CAT#: TP305503M

Recombinant protein of human N-acetylneuraminic acid phosphatase (NANP), 100 µg

Product Images

Coomassie blue staining of purified NANP protein (Cat# TP305503). The protein was produced from HEK293T cells transfected with NANP cDNA clone (Cat# RC205503) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205503 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITD
  LRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQRE
  KIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWIN
  KNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689880
• Locus ID: 140838
• UniProt ID: Q8TBE9
• Cytogenetics: 20p11.21
• Refseq Size: 3806
• Refseq ORF: 744
• Synonyms: C20orf147; dJ694B14.3; HDHD4
• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Metabolic pathways