DPPA2 (NM_138815) Human Recombinant Protein
CAT#: TP305441
Purified recombinant protein of Human developmental pluripotency associated 2 (DPPA2), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
Frequently bought together (2)
Other products for "DPPA2"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205441 protein sequence
Red=Cloning site Green=Tags(s) MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQF TAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQE TRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVS VEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCP DCAKRNKKMMKRLMTVEK myc-FLAG tag |
Tag | Myc-DDK |
Predicted MW | 33.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620170 |
Locus ID | 151871 |
UniProt ID | Q7Z7J5 |
Cytogenetics | 3q13.13 |
Refseq Size | 1393 |
Refseq ORF | 894 |
Synonyms | CT100; ECAT15-2; PESCRG1 |
Summary | Binds to target gene promoters, including NKX2-5 and SYCE1, but not GATA4, and may be involved in the maintenance of the active epigenetic status of these genes.[UniProtKB/Swiss-Prot Function] |
Protein Families | Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP762010 | Purified recombinant protein of Human developmental pluripotency associated 2 (DPPA2),Met1-Val175, with N-terminal His tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.