DPPA2 (NM_138815) Human Recombinant Protein

CAT#: TP305441

Purified recombinant protein of Human developmental pluripotency associated 2 (DPPA2), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg

Product Images

Coomassie blue staining of purified DPPA2 protein (Cat# TP305441). The protein was produced from HEK293T cells transfected with DPPA2 cDNA clone (Cat# RC205441) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205441 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQF
  TAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQE
  TRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVS
  VEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCP
  DCAKRNKKMMKRLMTVEK
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 33.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_620170
• Locus ID: 151871
• UniProt ID: Q7Z7J5
• Cytogenetics: 3q13.13
• Refseq Size: 1393
• Refseq ORF: 894
• Synonyms: CT100; ECAT15-2; PESCRG1
• Summary: Binds to target gene promoters, including NKX2-5 and SYCE1, but not GATA4, and may be involved in the maintenance of the active epigenetic status of these genes.[UniProtKB/Swiss-Prot Function]
• Protein Families: Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency