PPP3R2 (NM_147180) Human Recombinant Protein

CAT#: TP305406L

Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform (PPP3R2), 1 mg

Product Images

Coomassie blue staining of purified PPP3R2 protein (Cat# TP305406). The protein was produced from HEK293T cells transfected with PPP3R2 cDNA clone (Cat# RC205406) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205406 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGD
  GEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTI
  IILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_671709
• Locus ID: 5535
• UniProt ID: Q96LZ3, A0A494C014
• Cytogenetics: 9q31.1
• Refseq Size: 3401
• Refseq ORF: 519
• Synonyms: PPP3RL
• Summary: Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.[UniProtKB/Swiss-Prot Function]
• Protein Families: Phosphatase
• Protein Pathways: Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway