CD83 (NM_004233) Human Recombinant Protein

CAT#: TP305302

Recombinant protein of human CD83 molecule (CD83), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified CD83 protein (Cat# TP305302). The protein was produced from HEK293T cells transfected with CD83 cDNA clone (Cat# RC205302) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205302 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRG
  QHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKK
  YRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004224
• Locus ID: 9308
• UniProt ID: Q01151
• Cytogenetics: 6p23
• Refseq Size: 2478
• Refseq ORF: 615
• Synonyms: BL11; HB15
• Summary: The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
• Protein Families: Transmembrane