LRRC20 (NM_207119) Human Recombinant Protein
CAT#: TP305227
Recombinant protein of human leucine rich repeat containing 20 (LRRC20), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205227 protein sequence
Red=Cloning site Green=Tags(s) MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFM TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKL AAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997002 |
Locus ID | 55222 |
UniProt ID | Q8TCA0, A0A024QZM2 |
Cytogenetics | 10q22.1 |
Refseq Size | 3428 |
Refseq ORF | 552 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404053 | LRRC20 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC413250 | LRRC20 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404053 | Transient overexpression lysate of leucine rich repeat containing 20 (LRRC20), transcript variant 1 |
USD 436.00 |
|
LY413250 | Transient overexpression lysate of leucine rich repeat containing 20 (LRRC20), transcript variant 3 |
USD 436.00 |
|
PH305227 | LRRC20 MS Standard C13 and N15-labeled recombinant protein (NP_997002) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review