CHAC2 (NM_001008708) Human Recombinant Protein

CAT#: TP305083

Recombinant protein of human ChaC, cation transport regulator homolog 2 (E. coli) (CHAC2), 20 µg

Product Images

Coomassie blue staining of purified CHAC2 protein (Cat# TP305083). The protein was produced from HEK293T cells transfected with CHAC2 cDNA clone (Cat# RC205083) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205083 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVG
  KEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGR
  NTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001008708
• Locus ID: 494143
• UniProt ID: Q8WUX2
• Cytogenetics: 2p16.2
• Refseq Size: 1305
• Refseq ORF: 552
• Synonyms: GCG1
• Summary: The protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis. [provided by RefSeq, Sep 2016]