MIR16 (GDE1) (NM_016641) Human Recombinant Protein

CAT#: TP304923

Recombinant protein of human glycerophosphodiester phosphodiesterase 1 (GDE1), 20 µg

Product Images

Coomassie blue staining of purified GDE1 protein (Cat# TP304923). The protein was produced from HEK293T cells transfected with GDE1 cDNA clone (Cat# RC204923) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204923 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWLWEDQGGLLGPFSFLLLVLLLVTRSPVNACLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAH
  RGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLNPA
  ANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAHKATEALKKMYMEFPQLYNNSVVCSFLPEVI
  YKMRQTDRDVITALTHRPWSLSHTGDGKPRYDTFWKHFIFVMMDILLDWSMHNILWYLCGISAFLMQKDF
  VSPAYLKKWSAKGIQVVGWTVNTFDEKSYYESHLGSSYITDSMVEDCEPHF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057725
• Locus ID: 51573
• UniProt ID: Q9NZC3
• Cytogenetics: 16p12.3
• Refseq Size: 2960
• Refseq ORF: 993
• Synonyms: 363E6.2; MIR16
• Summary: Has glycerophosphoinositol phosphodiesterase activity. Hydrolyzes lysoglycerophospholipids to produce lysophosphatidic acid (LPA) and the corresponding amines. Has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: Glycerophospholipid metabolism