XPA (NM_000380) Human Recombinant Protein
CAT#: TP304872
Purified recombinant protein of Human xeroderma pigmentosum, complementation group A (XPA), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204872 protein sequence
Red=Cloning site Green=Tags(s) MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIID TGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLIT KTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQEN REKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000371 |
Locus ID | 7507 |
UniProt ID | P23025 |
Cytogenetics | 9q22.33 |
Refseq Size | 1491 |
Refseq ORF | 819 |
Synonyms | XP1; XPAC |
Summary | This gene encodes a zinc finger protein plays a central role in nucleotide excision repair (NER), a specialized type of DNA repair. NER is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens and chemotherapeutic drugs. The encoded protein interacts with DNA and several NER proteins, acting as a scaffold to assemble the NER incision complex at sites of DNA damage. Mutations in this gene cause Xeroderma pigmentosum complementation group A (XP-A), an autosomal recessive skin disorder featuring hypersensitivity to sunlight and increased risk for skin cancer. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424749 | XPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424749 | Transient overexpression lysate of xeroderma pigmentosum, complementation group A (XPA), transcript variant 1 |
USD 436.00 |
|
PH304872 | XPA MS Standard C13 and N15-labeled recombinant protein (NP_000371) |
USD 3,255.00 |
|
TP762531 | Purified recombinant protein of Human xeroderma pigmentosum, complementation group A (XPA), transcript variant 1, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review