XPA (NM_000380) Human Recombinant Protein

CAT#: TP304872

Purified recombinant protein of Human xeroderma pigmentosum, complementation group A (XPA), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg

Product Images

Coomassie blue staining of purified XPA protein (Cat# TP304872). The protein was produced from HEK293T cells transfected with XPA cDNA clone (Cat# RC204872) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204872 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIID
  TGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLIT
  KTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQEN
  REKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000371
• Locus ID: 7507
• UniProt ID: P23025
• Cytogenetics: 9q22.33
• Refseq Size: 1491
• Refseq ORF: 819
• Synonyms: XP1; XPAC
• Summary: This gene encodes a zinc finger protein plays a central role in nucleotide excision repair (NER), a specialized type of DNA repair. NER is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens and chemotherapeutic drugs. The encoded protein interacts with DNA and several NER proteins, acting as a scaffold to assemble the NER incision complex at sites of DNA damage. Mutations in this gene cause Xeroderma pigmentosum complementation group A (XP-A), an autosomal recessive skin disorder featuring hypersensitivity to sunlight and increased risk for skin cancer. [provided by RefSeq, Aug 2017]
• Protein Families: Druggable Genome
• Protein Pathways: Nucleotide excision repair