BACE2 (NM_012105) Human Recombinant Protein

CAT#: TP304860L

Recombinant protein of human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, 1 mg

Product Images

Coomassie blue staining of purified BACE2 protein (Cat# TP304860). The protein was produced from HEK293T cells transfected with BACE2 cDNA clone (Cat# RC204860) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204860 representing NM_012105
  Red=Cloning site Green=Tags(s)
  
  MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGLALALEPALAS
  PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRS
  KGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSS
  LETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILK
  LEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSET
  PWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD
  RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCGAILLVLIVLL
  LLPFRCQRRPRDPEVVNDESSLVRHRWK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 49.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036237
• Locus ID: 25825
• UniProt ID: Q9Y5Z0
• Cytogenetics: 21q22.2-q22.3
• Refseq Size: 2993
• Refseq ORF: 1554
• Synonyms: AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP
• Summary: This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer's disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome, Protease, Transmembrane
• Protein Pathways: Alzheimer's disease