EXOSC8 (NM_181503) Human Recombinant Protein

CAT#: TP304768M

Recombinant protein of human exosome component 8 (EXOSC8), 100 µg

Product Images

Coomassie blue staining of purified EXOSC8 protein (Cat# TP304768). The protein was produced from HEK293T cells transfected with EXOSC8 cDNA clone (Cat# RC204768) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204768 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPS
  TDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLI
  CLDYDGNILDACTFALLAALKNVQLPEVTINEETALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDP
  TGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_852480
• Locus ID: 11340
• UniProt ID: Q96B26
• Cytogenetics: 13q13.3
• Refseq Size: 1427
• Refseq ORF: 828
• Synonyms: bA421P11.3; CIP3; EAP2; OIP2; p9; PCH1C; RRP43; Rrp43p
• Summary: This gene encodes a 3'-5' exoribonuclease that specifically interacts with mRNAs containing AU-rich elements. The encoded protein is part of the exosome complex that is important for the degradation of numerous RNA species. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Mar 2009]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation