LOX 1 (OLR1) (NM_002543) Human Recombinant Protein

CAT#: TP304704

Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), 20 µg

Product Images

Coomassie blue staining of purified OLR1 protein (Cat# TP304704). The protein was produced from HEK293T cells transfected with OLR1 cDNA clone (Cat# RC204704) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204704 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE
  QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC
  SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN
  PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Binding assay (PMID: 28377266)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002534
• Locus ID: 4973
• UniProt ID: P78380, A0A024RAU0
• Cytogenetics: 12p13.2
• Refseq Size: 2533
• Refseq ORF: 819
• Synonyms: CLEC8A; LOX1; LOXIN; SCARE1; SLOX1
• Summary: This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: PPAR signaling pathway