RRP15 (NM_016052) Human Recombinant Protein

CAT#: TP304644M

Recombinant protein of human ribosomal RNA processing 15 homolog (S. cerevisiae) (RRP15), 100 µg

Product Images

Coomassie blue staining of purified RRP15 protein (Cat# TP304644). The protein was produced from HEK293T cells transfected with RRP15 cDNA clone (Cat# RC204644) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204644 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTNMGWA
  DAMAKVLNKKTPESKPTILVKNKKLEKEKEKLKQERLEKIKQRDKRLEWEMMCRVKPDVVQDKETERNLQ
  RIATRGVVQLFNAVQKHQKNVDEKVKEAGSSMRKRAKLISTVSKKDFISVLRGMDGSTNETASSRKKPKA
  KQTEVKSEEGPGWTILRDDFMMGASMKDWDKESDGPDDSRPESASDSDT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057136
• Locus ID: 51018
• UniProt ID: Q9Y3B9
• Cytogenetics: 1q41
• Refseq Size: 7782
• Refseq ORF: 777
• Synonyms: CGI-115; KIAA0507
• Summary: This gene encodes a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of pre-60S ribosomal particles, and is required for the early maturation steps of the 60S subunit. [provided by RefSeq, Jul 2008]