ICT1 (MRPL58) (NM_001545) Human Recombinant Protein

CAT#: TP304448

Recombinant protein of human immature colon carcinoma transcript 1 (ICT1), 20 µg

Product Images

Coomassie blue staining of purified MRPL58 protein (Cat# TP304448). The protein was produced from HEK293T cells transfected with MRPL58 cDNA clone (Cat# RC204448) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204448 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADS
  DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESS
  RYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001536
• Locus ID: 3396
• UniProt ID: Q14197
• Cytogenetics: 17q25.1
• Refseq Size: 888
• Refseq ORF: 618
• Synonyms: DS-1; DS1; ICT1; MRP-L58
• Summary: The protein encoded by this gene is a peptidyl-tRNA hydrolase and a vital component of the large mitochondrial ribosome. The encoded protein serves as a ribosome release factor for this ribosome, which translates mitochondrial genes. This protein may be responsible for degrading prematurely-terminated polypeptides and for reusing stalled ribosomes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]