GJB4 (NM_153212) Human Recombinant Protein

CAT#: TP304406

Recombinant protein of human gap junction protein, beta 4, 30.3kDa (GJB4), 20 µg

Product Images

Coomassie blue staining of purified GJB4 protein (Cat# TP304406). The protein was produced from HEK293T cells transfected with GJB4 cDNA clone (Cat# RC204406) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204406 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFP
  VSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAA
  VDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVG
  KRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_694944
• Locus ID: 127534
• UniProt ID: Q9NTQ9
• Cytogenetics: 1p34.3
• Refseq Size: 2840
• Refseq ORF: 798
• Synonyms: CX30.3; EKV; EKVP2
• Summary: This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations in this gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment. [provided by RefSeq, Dec 2009]
• Protein Families: Ion Channels: Other, Transmembrane