TST (NM_003312) Human Recombinant Protein
CAT#: TP304002
Recombinant protein of human thiosulfate sulfurtransferase (rhodanese) (TST), nuclear gene encoding mitochondrial protein, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204002 protein sequence
Red=Cloning site Green=Tags(s) MVHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDTASP YEMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHP VTSEPSRPEPAVFKATLDRSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDAVGLDSGHIRGAVN MPFMDFLTEDGFEKGPEELRALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWF RRAPPESRVSQGKSEKA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 33.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003303 |
Locus ID | 7263 |
UniProt ID | Q16762, A0A384NKQ2 |
Cytogenetics | 22q12.3 |
Refseq Size | 1143 |
Refseq ORF | 891 |
Synonyms | RDS |
Summary | This is one of two neighboring genes encoding similar proteins that each contain two rhodanese domains. The encoded protein is localized to the mitochondria and catalyzes the conversion of thiosulfate and cyanide to thiocyanate and sulfite. In addition, the protein interacts with 5S ribosomal RNA and facilitates its import into the mitochondria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418774 | TST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418774 | Transient overexpression lysate of thiosulfate sulfurtransferase (rhodanese) (TST), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
PH304002 | TST MS Standard C13 and N15-labeled recombinant protein (NP_003303) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review