ABHD11 (NM_148912) Human Recombinant Protein

CAT#: TP303904M

Recombinant protein of human abhydrolase domain containing 11 (ABHD11), transcript variant 1, 100 µg

Product Images

Coomassie blue staining of purified ABHD11 protein (Cat# TP303904). The protein was produced from HEK293T cells transfected with ABHD11 cDNA clone (Cat# RC203904) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203904 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEPRPLPLSYRLLDGEAALPAVV
  FLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGH
  SMGGKTAMLLALQRPELVERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLSSVI
  QDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIM
  RLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_683710
• Locus ID: 83451
• UniProt ID: Q8NFV4
• Cytogenetics: 7q11.23
• Refseq Size: 1467
• Refseq ORF: 945
• Synonyms: PP1226; WBSCR21
• Summary: This gene encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [provided by RefSeq, Mar 2016]