TIM 4 (TIMD4) (NM_138379) Human Recombinant Protein

CAT#: TP303848

Recombinant protein of human T-cell immunoglobulin and mucin domain containing 4 (TIMD4), 20 µg

Product Images

Coomassie blue staining of purified TIMD4 protein (Cat# TP303848). The protein was produced from HEK293T cells transfected with TIMD4 cDNA clone (Cat# RC203848) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203848 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIR
  TDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHR
  TATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEAT
  GLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQP
  GASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQLLMIIAPSLGFVLFALFVAFLLRGKLMETYCSQKHT
  RLDYIGDSKNVLNDVQHGREDEDGLFTL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_612388
• Locus ID: 91937
• UniProt ID: Q96H15
• Cytogenetics: 5q33.3
• Refseq Size: 1374
• Refseq ORF: 1134
• Synonyms: SMUCKLER; TIM4
• Summary: Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Involved in regulating T-cell proliferation and lymphotoxin signaling. Ligand for HAVCR1/TIMD1 (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane