OXCT1 (NM_000436) Human Recombinant Protein

CAT#: TP303764L

Recombinant protein of human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein, 1 mg

Product Images

Coomassie blue staining of purified OXCT1 protein (Cat# TP303764). The protein was produced from HEK293T cells transfected with OXCT1 cDNA clone (Cat# RC203764) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203764 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVLVGGFGLCGIP
  ENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGT
  LAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALV
  KAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIE
  RLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGL
  GPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV
  KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELW
  EGLTVDDVQKSTGCDFAVSPKLMPMQQIAN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 52 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000427
• Locus ID: 5019
• UniProt ID: P55809, A0A024R040
• Cytogenetics: 5p13.1
• Refseq Size: 3572
• Refseq ORF: 1560
• Synonyms: OXCT; SCOT
• Summary: This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency. [provided by RefSeq, Jul 2008]
• Protein Pathways: Butanoate metabolism, Synthesis and degradation of ketone bodies, Valine, leucine and isoleucine degradation