Phosphatidic acid phosphatase type 2B (PLPP3) (NM_003713) Human Recombinant Protein
CAT#: TP303480
Recombinant protein of human phosphatidic acid phosphatase type 2B (PPAP2B), transcript variant 1, 20 µg
View other "Phosphatidic acid phosphatase type 2B" proteins (3)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203480 protein sequence
Red=Cloning site Green=Tags(s) MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCND ESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAIS QSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYL VLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKT KMTLSLPAPAIRKEILSPVDIIDRNNHHNMM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003704 |
Locus ID | 8613 |
UniProt ID | O14495 |
Cytogenetics | 1p32.2 |
Refseq Size | 3324 |
Refseq ORF | 933 |
Synonyms | Dri42; LPP3; PAP2B; PPAP2B; VCIP |
Summary | The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Ether lipid metabolism, Fc gamma R-mediated phagocytosis, Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Sphingolipid metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418485 | PPAP2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418485 | Transient overexpression lysate of phosphatidic acid phosphatase type 2B (PPAP2B), transcript variant 1 |
USD 436.00 |
|
PH303480 | PPAP2B MS Standard C13 and N15-labeled recombinant protein (NP_003704) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review