Phosphatidic acid phosphatase type 2B (PLPP3) (NM_003713) Human Recombinant Protein

CAT#: TP303480

Recombinant protein of human phosphatidic acid phosphatase type 2B (PPAP2B), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified PLPP3 protein (Cat# TP303480). The protein was produced from HEK293T cells transfected with PLPP3 cDNA clone (Cat# RC203480) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203480 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCND
  ESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAIS
  QSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYL
  VLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKT
  KMTLSLPAPAIRKEILSPVDIIDRNNHHNMM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003704
• Locus ID: 8613
• UniProt ID: O14495
• Cytogenetics: 1p32.2
• Refseq Size: 3324
• Refseq ORF: 933
• Synonyms: Dri42; LPP3; PAP2B; PPAP2B; VCIP
• Summary: The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. [provided by RefSeq, Mar 2010]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Ether lipid metabolism, Fc gamma R-mediated phagocytosis, Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Sphingolipid metabolism