C2orf43 (LDAH) (NM_021925) Human Recombinant Protein

CAT#: TP303367

Recombinant protein of human chromosome 2 open reading frame 43 (C2orf43), 20 µg

Product Images

Coomassie blue staining of purified LDAH protein (Cat# TP303367). The protein was produced from HEK293T cells transfected with LDAH cDNA clone (Cat# RC203367) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203367 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSELKEEIPVHEEFILCGGAETQVLKCGPWTDLFHDQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSL
  TNRRFPVWTISHAGHALAPKDKKILTTSEDSNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSI
  GSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKPCPETIKSLLI
  RRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYE
  DIKKDFPEGDIRLCEKNIPHAFITHFNQEMADMIADSLKDDLSKM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_068744
• Locus ID: 60526
• UniProt ID: Q9H6V9
• Cytogenetics: 2p24.1
• Refseq Size: 3963
• Refseq ORF: 975
• Synonyms: C2orf43; hLDAH
• Summary: Serine lipid hydrolase associated with lipid droplets. Highly expressed in macrophage-rich areas in atherosclerotic lesions, suggesting that it could promote cholesterol ester turnover in macrophages.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome