C2orf43 (LDAH) (NM_021925) Human Mass Spec Standard

CAT#: PH303367

C2orf43 MS Standard C13 and N15-labeled recombinant protein (NP_068744)

Product Images

Coomassie blue staining of purified LDAH protein (Cat# TP303367). The protein was produced from HEK293T cells transfected with LDAH cDNA clone (Cat# RC203367) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203367
• Predicted MW: 37.3 kDa
• Protein Sequence:
  Sequence Link

  >RC203367 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSELKEEIPVHEEFILCGGAETQVLKCGPWTDLFHDQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSL
  TNRRFPVWTISHAGHALAPKDKKILTTSEDSNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSI
  GSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKPCPETIKSLLI
  RRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYE
  DIKKDFPEGDIRLCEKNIPHAFITHFNQEMADMIADSLKDDLSKM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068744
• RefSeq Size: 3963
• RefSeq ORF: 975
• Synonyms: C2orf43; hLDAH
• Locus ID: 60526
• UniProt ID: Q9H6V9
• Cytogenetics: 2p24.1
• Summary: Serine lipid hydrolase associated with lipid droplets. Highly expressed in macrophage-rich areas in atherosclerotic lesions, suggesting that it could promote cholesterol ester turnover in macrophages.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome