IP10 (CXCL10) (NM_001565) Human Recombinant Protein

CAT#: TP303141L

Recombinant protein of human chemokine (C-X-C motif) ligand 10 (CXCL10), 1 mg

Product Images

Coomassie blue staining of purified CXCL10 protein (Cat# TP303141). The protein was produced from HEK293T cells transfected with CXCL10 cDNA clone (Cat# RC203141) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203141 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKG
  EKRCLNPESKAIKNLLKAVSKERSKRSP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001556
• Locus ID: 3627
• UniProt ID: P02778
• Cytogenetics: 4q21.1
• Refseq Size: 1227
• Refseq ORF: 294
• Synonyms: C7; crg-2; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10
• Summary: This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection. [provided by RefSeq, Sep 2020]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway