MAP6D1 (NM_024871) Human Recombinant Protein

CAT#: TP302993

Purified recombinant protein of Homo sapiens MAP6 domain containing 1 (MAP6D1), 20 µg

Product Images

Coomassie blue staining of purified MAP6D1 protein (Cat# TP302993). The protein was produced from HEK293T cells transfected with MAP6D1 cDNA clone (Cat# RC202993) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202993 representing NM_024871
  Red=Cloning site Green=Tags(s)
  
  MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDSGRDVPLTQYQ
  RDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAW
  TGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAPRILNV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079147
• Locus ID: 79929
• UniProt ID: Q9H9H5
• Cytogenetics: 3q27.1
• Refseq Size: 2104
• Refseq ORF: 597
• Synonyms: MAPO6D1; SL21
• Summary: This gene encodes a protein highly similar to the mouse MAP6 domain containing 1 protein, which is related to the STOP proteins. Based on the study of the mouse protein, the encoded protein may function as a calmodulin-regulated neuronal protein that binds and stabilizes microtubules but also associates with the Golgi membranes through N-terminal palmitoylation. [provided by RefSeq, Oct 2008]