MAP6D1 (NM_024871) Human Mass Spec Standard

CAT#: PH302993

MAP6D1 MS Standard C13 and N15-labeled recombinant protein (NP_079147)

Product Images

Coomassie blue staining of purified MAP6D1 protein (Cat# TP302993). The protein was produced from HEK293T cells transfected with MAP6D1 cDNA clone (Cat# RC202993) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202993
• Predicted MW: 20.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202993 representing NM_024871
  Red=Cloning site Green=Tags(s)
  
  MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDSGRDVPLTQYQ
  RDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAW
  TGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAPRILNV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079147
• RefSeq Size: 2104
• RefSeq ORF: 597
• Synonyms: MAPO6D1; SL21
• Locus ID: 79929
• UniProt ID: Q9H9H5
• Cytogenetics: 3q27.1
• Summary: This gene encodes a protein highly similar to the mouse MAP6 domain containing 1 protein, which is related to the STOP proteins. Based on the study of the mouse protein, the encoded protein may function as a calmodulin-regulated neuronal protein that binds and stabilizes microtubules but also associates with the Golgi membranes through N-terminal palmitoylation. [provided by RefSeq, Oct 2008]