HYI (NM_031207) Human Recombinant Protein

CAT#: TP302991M

Recombinant protein of human hydroxypyruvate isomerase homolog (E. coli) (HYI), 100 µg

Product Images

Coomassie blue staining of purified HYI protein (Cat# TP302991). The protein was produced from HEK293T cells transfected with HYI cDNA clone (Cat# RC202991) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202991 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQE
  DLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQV
  AQVPGRGEPSSPGELNFPYLFQLLENEGYKGFVGCEYQPRGDTVEGLSWLRSYWDRRATQRLASEGPHTT
  HVPPDSE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_112484
• Locus ID: 81888
• UniProt ID: Q5T013, Q5T013-3
• Cytogenetics: 1p34.2
• Refseq Size: 1251
• Refseq ORF: 1365
• Synonyms: HT036
• Summary: This gene encodes a putative hydroxypyruvate isomerase, which likely catalyzes the conversion of hydroxypyruvate to 2-hydroxy-3-oxopropanoate, and may be involved in carbohydrate transport and metabolism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
• Protein Pathways: Glyoxylate and dicarboxylate metabolism, Metabolic pathways