SYT17 (NM_016524) Human Recombinant Protein

CAT#: TP302628

Recombinant protein of human synaptotagmin XVII (SYT17), 20 µg

Product Images

Coomassie blue staining of purified SYT17 protein (Cat# TP302628). The protein was produced from HEK293T cells transfected with SYT17 cDNA clone (Cat# RC202628) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202628 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAYIQLEPLNEGFLSRISGLLLCRWTCRHCCQKCYESSCCQSSEDEVEILGPFPAQTPPWLMASRSSDKD
  GDSVHTASEVPLTPRTNSPDGRRSSSDTSKSTYSLTRRISSLESRRPSSPLIDIKPIEFGVLSAKKEPIQ
  PSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTVRVIEARD
  LPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVD
  FDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQ
  TDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSND
  FIGRIVIGQYSSGPSETNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 53.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057608
• Locus ID: 51760
• UniProt ID: Q9BSW7
• Cytogenetics: 16p12.3
• Refseq Size: 1912
• Refseq ORF: 1422
• Synonyms: Syt-17; sytXVII
• Summary: Plays a role in dendrite formation by melanocytes (PubMed:23999003).[UniProtKB/Swiss-Prot Function]