START domain containing 7 (STARD7) (NM_020151) Human Recombinant Protein

CAT#: TP302539

Recombinant protein of human StAR-related lipid transfer (START) domain containing 7 (STARD7), 20 µg

Product Images

Coomassie blue staining of purified STARD7 protein (Cat# TP302539). The protein was produced from HEK293T cells transfected with STARD7 cDNA clone (Cat# RC202539) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202539 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVM
  DKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHW
  VTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFD
  YLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSE
  RKNEGSCGPARIEYA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064536
• Locus ID: 56910
• UniProt ID: Q9NQZ5
• Cytogenetics: 2q11.2
• Refseq Size: 3394
• Refseq ORF: 885
• Synonyms: FAME2; GTT1
• Summary: May play a protective role in mucosal tissues by preventing exaggerated allergic responses.[UniProtKB/Swiss-Prot Function]