HSD17B14 (NM_016246) Human Recombinant Protein

CAT#: TP302531

Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 14 (HSD17B14), 20 µg

Product Images

Coomassie blue staining of purified HSD17B14 protein (Cat# TP302531). The protein was produced from HEK293T cells transfected with HSD17B14 cDNA clone (Cat# RC202531) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202531 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVK
  TLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINIS
  SLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGM
  LAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057330
• Locus ID: 51171
• UniProt ID: Q9BPX1, A0A140VJH8
• Cytogenetics: 19q13.33
• Refseq Size: 1277
• Refseq ORF: 810
• Synonyms: DHRS10; retSDR3; SDR47C1
• Summary: 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]).[supplied by OMIM, Jun 2009]
• Protein Families: Druggable Genome