GMPR1 (GMPR) (NM_006877) Human Recombinant Protein

CAT#: TP302453L

Recombinant protein of human guanosine monophosphate reductase (GMPR), 1 mg

Product Images

Coomassie blue staining of purified GMPR protein (Cat# TP302453). The protein was produced from HEK293T cells transfected with GMPR cDNA clone (Cat# RC202453) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202453 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQH
  SMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVE
  FVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAH
  GLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAG
  GVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006868
• Locus ID: 2766
• UniProt ID: P36959
• Cytogenetics: 6p22.3
• Refseq Size: 1515
• Refseq ORF: 1035
• Synonyms: GMPR 1; GMPR1
• Summary: This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of GMP to IMP. The protein also functions in the re-utilization of free intracellular bases and purine nucleosides.[provided by RefSeq, Oct 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Purine metabolism