DPF2 (NM_006268) Human Recombinant Protein

CAT#: TP302364M

Recombinant protein of human D4, zinc and double PHD fingers family 2 (DPF2), 100 µg

Product Images

Coomassie blue staining of purified DPF2 protein (Cat# TP302364). The protein was produced from HEK293T cells transfected with DPF2 cDNA clone (Cat# RC202364) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202364 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQ
  LYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDD
  DSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYA
  CDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDS
  KINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDR
  GYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 44 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006259
• Locus ID: 5977
• UniProt ID: Q92785, A0A024R582
• Cytogenetics: 11q13.1
• Refseq Size: 2545
• Refseq ORF: 1173
• Synonyms: CSS7; REQ; ubi-d4; UBID4
• Summary: The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors