LRRC51 (NM_145309) Human Recombinant Protein

CAT#: TP302297

Recombinant protein of human leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified LRTOMT protein (Cat# TP302297). The protein was produced from HEK293T cells transfected with LRTOMT cDNA clone (Cat# RC202297) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202297 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQV
  ASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPME
  EEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_660352
• Locus ID: 220074
• UniProt ID: Q96E66, A0A024R5L6
• Cytogenetics: 11q13.4
• Refseq Size: 2658
• Refseq ORF: 576
• Summary: This locus represents naturally occurring readthrough transcription between the neighboring LRRC51 (leucine-rich repeat containing 51) and TOMT (transmembrane O-methyltransferase) genes on chromosome 11. The readthrough transcript encodes a fusion protein that shares sequence identity with each individual gene product. Multiple reports implicate mutations in this gene in nonsyndromic deafness.[provided by RefSeq, Feb 2021]