Breast cancer suppressor candidate 1 (VWA5A) (NM_198315) Human Recombinant Protein
CAT#: TP301474
Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, 20 µg
View other "Breast cancer suppressor candidate 1" proteins (13)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201474 protein sequence
Red=Cloning site Green=Tags(s) MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDG KKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGA LRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGED KTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGHLMGDPSAMVSFYPNIPEDQPSNTCG EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_938057 |
Locus ID | 4013 |
UniProt ID | O00534 |
Cytogenetics | 11q24.2 |
Refseq Size | 1874 |
Refseq ORF | 1245 |
Synonyms | BCSC-1; BCSC1; LOH11CR2A |
Summary | May play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402354 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC405013 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427178 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY402354 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1 |
USD 665.00 |
|
LY405013 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2 |
USD 436.00 |
|
LY427178 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3 |
USD 665.00 |
|
PH301474 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_938057) |
USD 3,255.00 |
|
PH312185 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_055437) |
USD 3,255.00 |
|
PH326168 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_001123614) |
USD 3,255.00 |
|
TP312185 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, 20 µg |
USD 867.00 |
|
TP326168 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3, 20 µg |
USD 867.00 |
|
TP710317 | Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 515.00 |
|
TP761749 | Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review