SIX2 (NM_016932) Human Recombinant Protein

CAT#: TP301328

Recombinant protein of human SIX homeobox 2 (SIX2), 20 µg

Product Images

Coomassie blue staining of purified SIX2 protein (Cat# TP301328). The protein was produced from HEK293T cells transfected with SIX2 cDNA clone (Cat# RC201328) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201328 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKIL
  ESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLR
  EWYAHNPYPSPREKRELTEATGLTTTQVSNWFKNRRQRDRAAEAKERENNENSNSNSHNPLNGSGKSVLG
  SSEDEKTPSGTPDHSSSSPALLLSPPPPGLPSLHSLGHPPGPSAVPVPVPGGGGADPLQHHHGLQDSILN
  PMSANLVDLGS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_058628
• Locus ID: 10736
• UniProt ID: Q9NPC8, Q8TBA2
• Cytogenetics: 2p21
• Refseq Size: 2178
• Refseq ORF: 873
• Summary: This gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila 'sine oculis' homeobox protein. The encoded protein is a transcription factor which, like other members of this gene family, may be involved in limb or eye development. [provided by RefSeq, Dec 2008]
• Protein Families: Transcription Factors